Recombinant Human Parvalbumin alpha (PVALB)

Code CSB-EP019092HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
D22S749; MGC116759; Parvalbumin alpha; PRVA_HUMAN; PVALB
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-110aa
Target Protein Sequence
SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
27.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.
Gene References into Functions
  1. These results demonstrate a specific association between elevated PVALB methylation and METH-induced psychosis. PMID: 28835159
  2. Our data support the hypothesis that the loss of PVALB plays a role in the pathogenesis of thyroid tumors. PMID: 27458244
  3. This study showed that the density of parvalbumin was significantly diminished in the basolateral complex in patients with Parkinson Disease. PMID: 28859333
  4. The results of this study suggested that innervation from PV-containing thalamic nuclei extends across superficial and middle layers of the human dorsolateral prefrontal cortex. PMID: 28074478
  5. This study demonstrated that A reduction of PV-positive cells and PV-immunoreactivity was observed exclusively in FCD type I/III specimens compared with cryptogenic tissue from control patients with a poor postsurgical outcome. PMID: 27173597
  6. excitatory synapse density is lower selectively on parvalbumin interneurons in schizophrenia and predicts the activity-dependent down-regulation of parvalbumin and GAD67 PMID: 27444795
  7. Increased numbers of PVALB neurons and fiber labeling in focal cortical dysplasia compared to nondysplastic epileptic temporal neocortex and postmortem controls may be related to cortical malformation. PMID: 26081613
  8. TRPV1-, TRPV2-, P2X3-, and parvalbumin-immunoreactivity neurons in the human nodose ganglion innervate the pharynx and epiglottis through the pharyngeal branch and superior laryngeal nerve PMID: 24764033
  9. This study demonistrated that differentially expressed in PV neurons in subjects with schizophrenia, including genes associated with WNT (wingless-type), NOTCH, and PGE2 (prostaglandin E2) signaling. PMID: 24628518
  10. This study showed that the parvalbumin basket cell inputs in the dorsolateral prefrontal cortex were lower in patient with schizophrenia. PMID: 24217255
  11. mRNA labeling at the single cell level shows a significant decrease in parvalbumin expression in Parkinson's (PD) cases; however, neuronal density of parvalbumin-positive neurons was not significantly different between PD patients and controls. PMID: 23891794
  12. This study demonistrated that loss of parvalbium immunoreactive axons in anterolateral columns of spinal cord in patient of lateral sclerosis spinal cords PMID: 23764361
  13. A subpopulation of projection neurons containing calcium-binding protein parvalbumin (PV) is identified in a precise mapping of the GABAergic cortical distribution. PMID: 23254904
  14. Parvalbumin neurons decrease the drive of the input to the visual cortex in contrast sensitivity. PMID: 23825418
  15. Data show calbindin (CB)- and tyrosine hydroxylase (TH)-cells were distributed in the three striatal territories, and the density of calretinin (CR) and parvalbumin (PV) interneurons were more abundant in the associative and sensorimotor striatum. PMID: 22272358
  16. PVALB is a novel diagnostic marker for Hurthle ademonas of the thyroid. PMID: 20926528
  17. parvalbumin has a role in calcium handling in cardiac diastolic dysfunction [review] PMID: 20093724
  18. In subjects with schizophrenia a reduction in parvalbumin [PV] and GAD67 mRNA expression in prefrontal cortex neurons was noted PMID: 12867516
  19. Slow relaxation caused by alpha-Tm mutants can be corrected by modifying calcium handling with parvalbumin. PMID: 15059934
  20. In dopaminergic cells of the substantia nigra in Parkinson disease an increased parvalbumin content is detected reflecting a natural protective mechanism against putative increase of intracellular calcium caused by excitotoxic injury and oxidative stress. PMID: 15257133
  21. demonstration of a reduced number of parvalbumin-immunoreactive projection neurons in the mammillary bodies in schizophrenia PMID: 17405923
  22. There is no correlation between total neuronal loss and PV-ir neuronal loss in any of the hippocampal fields in epileptic patient. PMID: 17850980
  23. The results of this study indicate a significant reduction in the number of PV interneurons within layer 2 of the multiple sclerosis primary motor cortex PMID: 18297277
  24. sequencing of PVALB was performed in 132 cases of Gitelman's syndrome in whom only one or no (N = 79) mutant SLC12A3 allele was found PMID: 18469313

Show More

Hide All

Protein Families
Parvalbumin family
Database Links

HGNC: 9704

OMIM: 168890

KEGG: hsa:5816

STRING: 9606.ENSP00000216200

UniGene: Hs.295449

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*